PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010541388.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 232aa    MW: 26168.2 Da    PI: 8.2676
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010541388.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.46.9e-184186148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg++T++E+ l +++++++G++ W++Iar+++ gRt++++k++w++++
   XP_010541388.1 41 RGKMTPQEERLVLELHAKWGNR-WSKIARKLP-GRTDNEIKNYWRTHM 86
                     89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.693135IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.2E-92147IPR009057Homeodomain-like
SuperFamilySSF466895.43E-222191IPR009057Homeodomain-like
PROSITE profilePS5129427.8143690IPR017930Myb domain
SMARTSM007172.2E-174088IPR001005SANT/Myb domain
PfamPF002492.5E-164185IPR001005SANT/Myb domain
CDDcd001677.41E-134386No hitNo description
Gene3DG3DSA:1.10.10.606.7E-214887IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MGFYCQSFRF EGGGRNIIGL NRTGKSCRLR WGNYLHPGLK RGKMTPQEER LVLELHAKWG  60
NRWSKIARKL PGRTDNEIKN YWRTHMRKKA QEKKRSTSPT SSSSNCCSST VTSANTQDSL  120
LSPDSGKASF YDTGGFDGKL NQGVEGCEEG YSMDDIWKEI DQSEANTIKP VRDFYAEQSW  180
FFNCLPLASP AWESPLDSIW NTEADESKMS IAIDQFPLCP EYGRSSSSSL AS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A8e-19229037105MYB PROTO-ONCOGENE PROTEIN
1h88_C3e-18229091159MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-18229091159MYB PROTO-ONCOGENE PROTEIN
1h8a_C1e-18229060128MYB TRANSFORMING PROTEIN
1mse_C8e-19229037105C-Myb DNA-Binding Domain
1msf_C8e-19229037105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0752531e-105DQ075253.1 Arabidopsis thaliana MYB transcription factor MYB59-2 (At5g59780) mRNA, complete cds, alternatively spliced.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010541388.11e-174PREDICTED: transcription factor MYB59 isoform X2
SwissprotQ4JL843e-93MYB59_ARATH; Transcription factor MYB59
TrEMBLV4KWJ11e-101V4KWJ1_EUTSA; Uncharacterized protein
STRINGBra006694.1-P8e-93(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.21e-100myb domain protein 59